Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM3 Peptide - middle region

CEACAM3 Peptide - middle region

Product Specifications

Product Name Alternative

CEA, CGM1, W264, W282, CD66D

UniProt

P40198

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001264092.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2E)-Decenal
TRC-C475100-50G 50 g

(2E)-Decenal

Sign In for Pricing
View Details
TCP1 delta (CCT4) (NM_006430) Human Recombinant Protein
TP314480 20 µg

TCP1 delta (CCT4) (NM_006430) Human Recombinant Protein

Sign In for Pricing
View Details
MAML3 (C-term) Rabbit Polyclonal Antibody
AP17543PU-N 400 µL

MAML3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Mouse Monoclonal Antibody [Clone ID: 2H2]
AM20209PU-N 100 µg

Biotin Mouse Monoclonal Antibody [Clone ID: 2H2]

Sign In for Pricing
View Details
MBNL2 Polyclonal Antibody
E-AB-90505-01 60 µL

MBNL2 Polyclonal Antibody

Sign In for Pricing
View Details
MBNL2 Polyclonal Antibody
E-AB-90505-02 120 µL

MBNL2 Polyclonal Antibody

Sign In for Pricing
View Details