What is the catalog number for PLOD1 Peptide - C-terminal region?

The catalog number for PLOD1 Peptide - C-terminal region is orb1999469.

What sizes are available for PLOD1 Peptide - C-terminal region?

PLOD1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is PLOD1 Peptide - C-terminal region in stock?

PLOD1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

PLOD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LH, LH1, LLH, EDS6, PLOD

UniProt

Q02809

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000293.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLAFVVRYKPDEQPSLMPHHDASTFTINIALNRVGVDYEGGGCRFLRYNC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA355232 2.5 mL

Calpain 3 (CAPN3) Mouse Monoclonal Antibody [Clone ID: Calp3d/2C4]

Sign In for Pricing

View Details

132976-ML490 100 µL

SARS2 (Seryl-tRNA Synthetase, Mitochondrial, Seryl-tRNA (Ser/Sec) Synthetase, Serine-tRNA Ligase, SerRS, SerRSmt, SARSM, FLJ20450) (MaxLight 490)

Sign In for Pricing

View Details

bs-10414R-PerCP 100 µL

Nanog Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing

View Details

TRV-0057866-01 20 µL

Polyclonal Antibody to Histamine Receptor H4 (HRH4)

Sign In for Pricing

View Details

TRV-0057866-02 100 µL

Polyclonal Antibody to Histamine Receptor H4 (HRH4)

Sign In for Pricing

View Details

TRV-0057866-03 200 µL

Polyclonal Antibody to Histamine Receptor H4 (HRH4)

Sign In for Pricing

View Details