CDO1 Peptide - middle region
CDO1 Peptide - middle region
Product Specifications
UniProt
Q16878
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001792.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10329483 96 Well
Porcine Ubiquitin related modifier 1 homolog (URM1) ELISA Kit
Sign In for Pricing
View Details 
MBS1498583-01 0.05 mg
Rabbit anti-human DnaJ homolog subfamily B member 2 polyclonal Antibody, HRP conjugated
Sign In for Pricing
View Details