What is the catalog number for RAB9A Peptide - middle region?

The catalog number for RAB9A Peptide - middle region is orb1999465.

What sizes are available for RAB9A Peptide - middle region?

RAB9A Peptide - middle region is available in the following size(s): 100 µg.

Is RAB9A Peptide - middle region in stock?

RAB9A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RAB9A Peptide - middle region

Product Specifications

Product Name Alternative

RAB9

UniProt

P51151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182257.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-47986JF549 0.1 mL

Mouse Monoclonal Cytokeratin 18 Antibody (KRT18/835) [Janelia Fluor 549]

Sign In for Pricing

View Details

NBP1-78085AF647 0.1 mL

Rabbit Polyclonal CELA1 Antibody [Alexa Fluor 647]

Sign In for Pricing

View Details

HT313014-01 50 µg

Anti-Human DDX3X Polyclonal Antibody

Sign In for Pricing

View Details

HT313014-02 100 µg

Anti-Human DDX3X Polyclonal Antibody

Sign In for Pricing

View Details

TMAB-13698-01 50 μL

Anti-TPOR Polyclonal Antibody 2

Sign In for Pricing

View Details

TMAB-13698-02 100 µL

Anti-TPOR Polyclonal Antibody 2

Sign In for Pricing

View Details