What is the catalog number for RAB9A Peptide - middle region?

The catalog number for RAB9A Peptide - middle region is orb1999465.

What sizes are available for RAB9A Peptide - middle region?

RAB9A Peptide - middle region is available in the following size(s): 100 µg.

Is RAB9A Peptide - middle region in stock?

RAB9A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

RAB9A Peptide - middle region

Product Specifications

Product Name Alternative

RAB9

UniProt

P51151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182257.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-99299AF750 0.1 mL

Rabbit Polyclonal NEURL Antibody [Alexa Fluor 750]

Sign In for Pricing

View Details

SLD01006-01 50 mg

Tert-Butyl 5-oxa-2,8-diazaspiro[3.4]octane-2-carboxylate

Sign In for Pricing

View Details

SLD01006-02 0.5 g

Tert-Butyl 5-oxa-2,8-diazaspiro[3.4]octane-2-carboxylate

Sign In for Pricing

View Details

NBP2-52640AF700 0.1 mL

Rabbit Monoclonal hapten 4-hydroxy-3-nitrophenyl acetyl (NP) Antibody (B1-8) [Alexa Fluor 700]

Sign In for Pricing

View Details

4040350/4 1 Each

Anopheles Male adult WM

Sign In for Pricing

View Details

PV313250 500 ng

TSC22D2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing

View Details