Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX2 Peptide - middle region

SNX2 Peptide - middle region

Product Specifications

Product Name Alternative

TRG-9

UniProt

O60749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001265128.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAAS (Aladin, Adracalin, ADRACALA, GL003) (MaxLight 550)
122774-ML550 100 µL

AAAS (Aladin, Adracalin, ADRACALA, GL003) (MaxLight 550)

Sign In for Pricing
View Details
Epyc (NM_001108088) Rat Tagged ORF Clone Lentiviral Particle
RR212769L4V 200 µL

Epyc (NM_001108088) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RDH13 sgRNA CRISPR Lentivector (Human) (Target 2)
K1805303 1.0 µg DNA

RDH13 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Sheep Neospora caninum (N.caninum) ELISA Kit
NSL0032Sp 96 Tests

Sheep Neospora caninum (N.caninum) ELISA Kit

Sign In for Pricing
View Details
Human CPLX4 activation kit by CRISPRa
GA117413 1 Kit

Human CPLX4 activation kit by CRISPRa

Sign In for Pricing
View Details
ATG14 Rabbit Polyclonal Antibody (PE-Cy7)
orb952299 100 µL

ATG14 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details