SNX2 Peptide - middle region
SNX2 Peptide - middle region
Product Specifications
Product Name Alternative
TRG-9
UniProt
O60749
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001265128.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
033632-ML405 100 µL
CDH3, CT (CDH3, CDHP, Cadherin-3, Placental cadherin) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
296599-01 1 mg
2-Acetamido-4-O- (2-O-benzoyl-3,4,6-tri-O-benzyl-b-D-galactopyranosyl) -1,6-di-O-benzyl-2-deoxy-b-D-glucopyranoside
Sign In for Pricing
View Details 296599-02 2 mg
2-Acetamido-4-O- (2-O-benzoyl-3,4,6-tri-O-benzyl-b-D-galactopyranosyl) -1,6-di-O-benzyl-2-deoxy-b-D-glucopyranoside
Sign In for Pricing
View Details 296599-03 5 mg
2-Acetamido-4-O- (2-O-benzoyl-3,4,6-tri-O-benzyl-b-D-galactopyranosyl) -1,6-di-O-benzyl-2-deoxy-b-D-glucopyranoside
Sign In for Pricing
View Details abx446713 100 µg
Unc-51 Like Autophagy Activating Kinase 2 (ULK2) Antibody (ALP)
Sign In for Pricing
View Details 