Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP6 Peptide - middle region

TRIP6 Peptide - middle region

Product Specifications

Product Name Alternative

OIP1, OIP-1, ZRP-1, TRIP-6, TRIP6i2

UniProt

Q15654

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003293.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drebrin 1 (DBN1) (DBN1/2879), CF568 conjugate, 0.1mg/mL
BNC682879-500 1x 500 µL

Drebrin 1 (DBN1) (DBN1/2879), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR4746 Human qPCR Primer Pair (MI0017385)
HP301132 200 Reactions

MIR4746 Human qPCR Primer Pair (MI0017385)

Sign In for Pricing
View Details
Metahexamide
TRC-M225600-5MG 5 mg

Metahexamide

Sign In for Pricing
View Details
Vertical Autoclave BAVT-303-A
BAVT-303-A 1 Unit

Vertical Autoclave BAVT-303-A

Sign In for Pricing
View Details
TIGIT Mouse Monoclonal Antibody [Clone ID: OTI9A12]
CF813032 100 µg

TIGIT Mouse Monoclonal Antibody [Clone ID: OTI9A12]

Sign In for Pricing
View Details
Tripelennamine Hydrochloride
TRC-T808325-1G 1 g

Tripelennamine Hydrochloride

Sign In for Pricing
View Details