Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIP6 Peptide - middle region

TRIP6 Peptide - middle region

Product Specifications

Product Name Alternative

OIP1, OIP-1, ZRP-1, TRIP-6, TRIP6i2

UniProt

Q15654

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003293.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Liver
CR561529 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
SPAG11A Human Gene Knockout Kit (CRISPR)
KN422447 1 Kit

SPAG11A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP60 Polyclonal Antibody
E-AB-70103-01 60 µL

HSP60 Polyclonal Antibody

Sign In for Pricing
View Details
HSP60 Polyclonal Antibody
E-AB-70103-02 120 µL

HSP60 Polyclonal Antibody

Sign In for Pricing
View Details
HSP60 Polyclonal Antibody
E-AB-70103-03 200 µL

HSP60 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Osteoprotegerin (OPG) ELISA Kit
RDR-OPG-Ra-01 96 Tests

Rat Osteoprotegerin (OPG) ELISA Kit

Sign In for Pricing
View Details