Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIT1 Peptide - middle region

NIT1 Peptide - middle region

Product Specifications

UniProt

Q86X76

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001172021.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)
MBS1331680-01 0.02 mg (E-Coli)

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)
MBS1331680-02 0.02 mg (Yeast)

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)
MBS1331680-03 0.1 mg (E-Coli)

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)
MBS1331680-04 0.1 mg (Yeast)

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)
MBS1331680-05 0.02 mg (Baculovirus)

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)
MBS1331680-06 0.02 mg (Mammalian-Cell)

Recombinant Human Ankyrin repeat domain-containing protein 42 (ANKRD42)

Sign In for Pricing
View Details