Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIT1 Peptide - middle region

NIT1 Peptide - middle region

Product Specifications

UniProt

Q86X76

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001172021.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLGGKLLEEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLNSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Gulono-1,4-lactone
163474 100 mg

D-Gulono-1,4-lactone

Sign In for Pricing
View Details
CHST4 Recombinant Protein (Human)
RP007099 100 µg

CHST4 Recombinant Protein (Human)

Sign In for Pricing
View Details
(2-Naphthyloxy) acetyl Chloride
418930-01 100 mg

(2-Naphthyloxy) acetyl Chloride

Sign In for Pricing
View Details
(2-Naphthyloxy) acetyl Chloride
418930-02 250 mg

(2-Naphthyloxy) acetyl Chloride

Sign In for Pricing
View Details
Lentiviral human STMN2 shRNA (UAS) - Lentiviral human STMN2 shRNA (UAS) plasmid
GTR15128107 1 Vial

Lentiviral human STMN2 shRNA (UAS) - Lentiviral human STMN2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Bacteria dnapkcs protein
orb604958-01 20 µg

Bacteria dnapkcs protein

Sign In for Pricing
View Details