Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RND2 Peptide - middle region

RND2 Peptide - middle region

Product Specifications

Product Name Alternative

ARHN, RHO7, RhoN

UniProt

P52198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005431.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZBTB26 activation kit by CRISPRa
GA111681 1 Kit

Human ZBTB26 activation kit by CRISPRa

Sign In for Pricing
View Details
CDX2 (GI Epithelial Marker) (CDX2/2951R), Biotin conjugate, 0.1mg/mL
BNCB2951-100 1x 100 µL

CDX2 (GI Epithelial Marker) (CDX2/2951R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody
RC-16745-01 50 μL

Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody

Sign In for Pricing
View Details
Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody
RC-16745-02 100 µL

Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody

Sign In for Pricing
View Details
Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody
RC-16745-03 1 mL

Recombinant PAK4 (phospho S474) /PAK5 (phospho S602) /PAK6 (phospho S560) Antibody

Sign In for Pricing
View Details
PODNL1 (NM_001146255) Human Over-expression Lysate
LC431364 20 µg

PODNL1 (NM_001146255) Human Over-expression Lysate

Sign In for Pricing
View Details