Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RND2 Peptide - middle region

RND2 Peptide - middle region

Product Specifications

Product Name Alternative

ARHN, RHO7, RhoN

UniProt

P52198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005431.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VATVASLGRGHRQLRRTDSRRGMQRSAQLSGRPDRGNEGEIHKDRAKSCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P57 / KIP2 (KIP2/880), CF405S conjugate, 0.1mg/mL
BNC040880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-01 50 μL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-02 100 µL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
Recombinant alpha Smooth Muscle Actin Antibody
RC-6367-03 1 mL

Recombinant alpha Smooth Muscle Actin Antibody

Sign In for Pricing
View Details
A 769662
TRC-A101205-25MG 25 mg

A 769662

Sign In for Pricing
View Details
Human SPATA18 activation kit by CRISPRa
GA115180 1 Kit

Human SPATA18 activation kit by CRISPRa

Sign In for Pricing
View Details