Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1E Peptide - middle region

CD1E Peptide - middle region

Product Specifications

Product Name Alternative

R2, CD1A

UniProt

P15812

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036048.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSCB Rabbit pAb (APR22552N)
APR22552N-01 50 µL

HSCB Rabbit pAb (APR22552N)

Sign In for Pricing
View Details
HSCB Rabbit pAb (APR22552N)
APR22552N-02 100 µL

HSCB Rabbit pAb (APR22552N)

Sign In for Pricing
View Details
HSCB Rabbit pAb (APR22552N)
APR22552N-03 200 µL

HSCB Rabbit pAb (APR22552N)

Sign In for Pricing
View Details
TUSC3 Rabbit pAb, BF700 conjugated
orb2853939 100 µL

TUSC3 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Ex 26 50 mg
5833/50 50 mg

Ex 26 50 mg

Sign In for Pricing
View Details
C9orf85 (NM_182505) Human Tagged ORF Clone
RG208807 10 µg

C9orf85 (NM_182505) Human Tagged ORF Clone

Sign In for Pricing
View Details