CD1E Peptide - middle region
CD1E Peptide - middle region
Product Specifications
Product Name Alternative
R2, CD1A
UniProt
P15812
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001036048.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-6099R-BF405 100 µL
SASH1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details MBS6153461-01 0.1 mL
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (HRP)
Sign In for Pricing
View Details MBS6153461-02 5x 0.1 mL
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (HRP)
Sign In for Pricing
View Details 
MBS9500083-01 1 Kit
CaMK2-beta/gamma/delta Colorimetric Cell-Based ELISA Kit
Sign In for Pricing
View Details MBS9500083-02 5x 1 Kit
CaMK2-beta/gamma/delta Colorimetric Cell-Based ELISA Kit
Sign In for Pricing
View Details