Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM4 Peptide - middle region

GSTM4 Peptide - middle region

Product Specifications

Product Name Alternative

GTM4, GSTM4-4

UniProt

P28161

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000841.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCM2 Rabbit Polyclonal Antibody
AP26022PU-N 100 µg

CCM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI8H7]
CF805262 100 µg

Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI8H7]

Sign In for Pricing
View Details
Pyridine-3,5-dicarboxamide
TRC-P993725-50MG 50 mg

Pyridine-3,5-dicarboxamide

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR560004 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Murashige & Skoog Basal Salts With Macronutrients, Micronutrients, Vitamins and Glycine
MSP09-5LT 5 L

Murashige & Skoog Basal Salts With Macronutrients, Micronutrients, Vitamins and Glycine

Sign In for Pricing
View Details
Il15 (NM_008357) Mouse Tagged ORF Clone
MG201274 10 µg

Il15 (NM_008357) Mouse Tagged ORF Clone

Sign In for Pricing
View Details