Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5R3 Peptide - middle region

CYB5R3 Peptide - middle region

Product Specifications

Product Name Alternative

B5R, DIA1

UniProt

P00387

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HERV-K_1q23.3 provirus ancestral Env polyprotein
MBS1138661 Inquire

Recombinant Human HERV-K_1q23.3 provirus ancestral Env polyprotein

Sign In for Pricing
View Details
Wiskostatin 50mg
A13903-50 50 mg

Wiskostatin 50mg

Sign In for Pricing
View Details
NDV HN Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-4529R-PerCP-Cy5.5 100 µL

NDV HN Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Ncoa7 3'UTR Luciferase Stable Cell Line
TU113899 1.0 mL

Ncoa7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HIBADH (NM_152740) Human Tagged ORF Clone
RC207125 10 µg

HIBADH (NM_152740) Human Tagged ORF Clone

Sign In for Pricing
View Details
PHA-680632 10mg
A10714-10 10 mg

PHA-680632 10mg

Sign In for Pricing
View Details