Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5R3 Peptide - middle region

CYB5R3 Peptide - middle region

Product Specifications

Product Name Alternative

B5R, DIA1

UniProt

P00387

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000389.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKFB2 Protein Vector (Mouse) (pPB-N-His)
PV215279 500 ng

PFKFB2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus pyrB Protein (aa 1-317)
VAng-Yyj5528-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Abscessus pyrB Protein (aa 1-317)

Sign In for Pricing
View Details
ANNEXIN-VII
HAR264-3ml 3 mL

ANNEXIN-VII

Sign In for Pricing
View Details
Mouse Tyrosine Hydroxylase, TH ELISA KIT
E1543Mo-01 48 Well

Mouse Tyrosine Hydroxylase, TH ELISA KIT

Sign In for Pricing
View Details
Mouse Tyrosine Hydroxylase, TH ELISA KIT
E1543Mo-02 96 Well

Mouse Tyrosine Hydroxylase, TH ELISA KIT

Sign In for Pricing
View Details
Mouse Tyrosine Hydroxylase, TH ELISA KIT
E1543Mo-03 5x 96 Tests

Mouse Tyrosine Hydroxylase, TH ELISA KIT

Sign In for Pricing
View Details