What is the catalog number for TACC1 Peptide - middle region?

The catalog number for TACC1 Peptide - middle region is orb1999454.

What sizes are available for TACC1 Peptide - middle region?

TACC1 Peptide - middle region is available in the following size(s): 100 µg.

Is TACC1 Peptide - middle region in stock?

TACC1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TACC1 Peptide - middle region

Product Specifications

Product Name Alternative

Ga55

UniProt

O75410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001116296.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-97957AF647 0.1 mL

Rabbit Polyclonal TBK1 Antibody [Alexa Fluor 647]

Sign In for Pricing

View Details

19124094 4x 500 ng

Eif3j-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing

View Details

MBS7207709-01 48 Well

Bovine ATP-binding cassette sub-family B member 5 (ABCB5) ELISA Kit

Sign In for Pricing

View Details

MBS7207709-02 96 Well

Bovine ATP-binding cassette sub-family B member 5 (ABCB5) ELISA Kit

Sign In for Pricing

View Details

MBS7207709-03 5x 96 Well

Bovine ATP-binding cassette sub-family B member 5 (ABCB5) ELISA Kit

Sign In for Pricing

View Details

MBS7207709-04 10x 96 Well

Bovine ATP-binding cassette sub-family B member 5 (ABCB5) ELISA Kit

Sign In for Pricing

View Details