TACC1 Peptide - middle region
TACC1 Peptide - middle region
Product Specifications
Product Name Alternative
Ga55
UniProt
O75410
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001116296.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1373502 1.0 µg DNA
MYF5 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
orb1650959-01 20 µg
Recombinant Bacillus subtilis Expansin-yoaJ (yoaJ)
Sign In for Pricing
View Details orb1650959-02 100 µg
Recombinant Bacillus subtilis Expansin-yoaJ (yoaJ)
Sign In for Pricing
View Details orb1650959-03 1 mg
Recombinant Bacillus subtilis Expansin-yoaJ (yoaJ)
Sign In for Pricing
View Details 50016116 3x 1.0 µg
Vom1r3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details