What is the catalog number for PDHX Peptide - middle region?

The catalog number for PDHX Peptide - middle region is orb1999452.

What sizes are available for PDHX Peptide - middle region?

PDHX Peptide - middle region is available in the following size(s): 100 µg.

Is PDHX Peptide - middle region in stock?

PDHX Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PDHX Peptide - middle region

Product Specifications

Product Name Alternative

E3BP, OPDX, PDX1, proX, DLDBP

UniProt

O00330

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128496.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV181072 500 ng

GALM Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details

16844116 3x 1.0 µg

Crlf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing

View Details

sc-166075 AF790 200 µg/mL

MAGP-1 (G-7) Alexa Fluor® 790

Sign In for Pricing

View Details

orb588800 100 µL

AIPL1 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

orb806071 2 mg

Jra Antibody

Sign In for Pricing

View Details

NBP2-97238-100ul 100 µL

Rabbit Polyclonal Carbohydrate Sulfotransferase 10/CHST10 Antibody

Sign In for Pricing

View Details