Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD9 Peptide - middle region

PSMD9 Peptide - middle region

Product Specifications

Product Name Alternative

P27, Rpn4

UniProt

O00233

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001248329.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQV

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRE Antibody
MBS8576657-01 0.2 mL

MRGPRE Antibody

Sign In for Pricing
View Details
MRGPRE Antibody
MBS8576657-02 0.1 mL (AF405L)

MRGPRE Antibody

Sign In for Pricing
View Details
MRGPRE Antibody
MBS8576657-03 0.1 mL (AF405S)

MRGPRE Antibody

Sign In for Pricing
View Details
MRGPRE Antibody
MBS8576657-04 0.1 mL (AF610)

MRGPRE Antibody

Sign In for Pricing
View Details
MRGPRE Antibody
MBS8576657-05 0.1 mL (AF635)

MRGPRE Antibody

Sign In for Pricing
View Details
MRGPRE Antibody
MBS8576657-06 0.1 mL (APC)

MRGPRE Antibody

Sign In for Pricing
View Details