What is the catalog number for PSMA7 Peptide - middle region?

The catalog number for PSMA7 Peptide - middle region is orb1999450.

What sizes are available for PSMA7 Peptide - middle region?

PSMA7 Peptide - middle region is available in the following size(s): 100 µg.

Is PSMA7 Peptide - middle region in stock?

PSMA7 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PSMA7 Peptide - middle region

Product Specifications

Product Name Alternative

C6, HSPC, RC6-1, XAPC7, HEL-S-276

UniProt

O14818

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002783.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-26072V 0.1 mL

Rabbit Polyclonal RAD9B Antibody [DyLight 405]

Sign In for Pricing

View Details

70R-51366 100 ul

CIC antibody

Sign In for Pricing

View Details

E30AC2059 100 µL

KRT15 Antibody

Sign In for Pricing

View Details

OKEH05183 96 Well

ILF3 ELISA Kit (Human) (OKEH05183)

Sign In for Pricing

View Details

RPC31846-01 20 µg

Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein

Sign In for Pricing

View Details

RPC31846-02 100 µg

Recombinant Human Alkaline phosphatase, placental type (ALPP), Active Protein

Sign In for Pricing

View Details