PSMA7 Peptide - middle region
PSMA7 Peptide - middle region
Product Specifications
Product Name Alternative
C6, HSPC, RC6-1, XAPC7, HEL-S-276
UniProt
O14818
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002783.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1090858-01 250 mg
1-bromo-3,5-dichloro-2- ((3-methylbenzyl) oxy) benzene
Sign In for Pricing
View Details OR1090858-02 500 mg
1-bromo-3,5-dichloro-2- ((3-methylbenzyl) oxy) benzene
Sign In for Pricing
View Details OR1090858-03 1 g
1-bromo-3,5-dichloro-2- ((3-methylbenzyl) oxy) benzene
Sign In for Pricing
View Details OR1090858-04 5 g
1-bromo-3,5-dichloro-2- ((3-methylbenzyl) oxy) benzene
Sign In for Pricing
View Details OR1090858-05 10 g
1-bromo-3,5-dichloro-2- ((3-methylbenzyl) oxy) benzene
Sign In for Pricing
View Details OR1090858-06 25 g
1-bromo-3,5-dichloro-2- ((3-methylbenzyl) oxy) benzene
Sign In for Pricing
View Details