Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX16 Peptide - middle region

PEX16 Peptide - middle region

Product Specifications

Product Name Alternative

PBD8A, PBD8B

UniProt

Q9Y5Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM165 (NM_018475) Human Tagged Lenti ORF Clone
RC210474L4 10 µg

TMEM165 (NM_018475) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)
MBS1242960-01 0.02 mg (E-Coli)

Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)
MBS1242960-02 0.1 mg (E-Coli)

Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)
MBS1242960-03 0.02 mg (Yeast)

Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)
MBS1242960-04 0.1 mg (Yeast)

Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)

Sign In for Pricing
View Details
Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)
MBS1242960-05 0.02 mg (Baculovirus)

Recombinant Nostoc sp. Phycoerythrocyanin subunit beta (pecB)

Sign In for Pricing
View Details