Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PEX16 Peptide - middle region

PEX16 Peptide - middle region

Product Specifications

Product Name Alternative

PBD8A, PBD8B

UniProt

Q9Y5Y5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004804.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP9 Polyclonal Antibody
ANT-10267-50ug 50 µg

AQP9 Polyclonal Antibody

Sign In for Pricing
View Details
Eotaxin Antibody
C30181-01 50 μL

Eotaxin Antibody

Sign In for Pricing
View Details
Eotaxin Antibody
C30181-02 100 µL

Eotaxin Antibody

Sign In for Pricing
View Details
1- (Bromomethyl) -4-chloro-2-methylbenzene
OR1072949-01 100 mg

1- (Bromomethyl) -4-chloro-2-methylbenzene

Sign In for Pricing
View Details
1- (Bromomethyl) -4-chloro-2-methylbenzene
OR1072949-02 250 mg

1- (Bromomethyl) -4-chloro-2-methylbenzene

Sign In for Pricing
View Details
1- (Bromomethyl) -4-chloro-2-methylbenzene
OR1072949-03 1 g

1- (Bromomethyl) -4-chloro-2-methylbenzene

Sign In for Pricing
View Details