What is the catalog number for ARR3 Peptide - middle region?

The catalog number for ARR3 Peptide - middle region is orb1999448.

What sizes are available for ARR3 Peptide - middle region?

ARR3 Peptide - middle region is available in the following size(s): 100 µg.

Is ARR3 Peptide - middle region in stock?

ARR3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ARR3 Peptide - middle region

Product Specifications

Product Name Alternative

ARRX

UniProt

P36575

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004303.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-340218 250 mg

2- (cyclopentylamino) ethan-1-ol hydrochloride

Sign In for Pricing

View Details

33R-5991 0.1 mg

DLG2 Blocking Peptide

Sign In for Pricing

View Details

NBP2-72529IR 0.1 mL

Mouse Monoclonal LRRC25 Antibody (OTI1A2) [DyLight 755]

Sign In for Pricing

View Details

31069 100 µL

DUSP6 Antibody

Sign In for Pricing

View Details

SSB60-RNA 10 mL

SS Beads 6.0mm RNase Free

Sign In for Pricing

View Details

CK-bio-11735-01 48 Tests

Human granulocyte chemotactic protein-2, GCP-2 ELISA Kit

Sign In for Pricing

View Details