Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETMAR Peptide - middle region

SETMAR Peptide - middle region

Product Specifications

Product Name Alternative

Mar1, HsMar1, METNASE

UniProt

Q53H47

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230652.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RORγt/DHODH-IN-3
HY-142847 1 Each

RORγt/DHODH-IN-3

Sign In for Pricing
View Details
FAM84B Antibody
MBS8582831-01 0.1 mL

FAM84B Antibody

Sign In for Pricing
View Details
FAM84B Antibody
MBS8582831-02 0.1 mL (AF635)

FAM84B Antibody

Sign In for Pricing
View Details
FAM84B Antibody
MBS8582831-03 0.1 mL (AF610)

FAM84B Antibody

Sign In for Pricing
View Details
FAM84B Antibody
MBS8582831-04 0.1 mL (AF405S)

FAM84B Antibody

Sign In for Pricing
View Details
FAM84B Antibody
MBS8582831-05 0.1 mL (AF405L)

FAM84B Antibody

Sign In for Pricing
View Details