Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETMAR Peptide - middle region

SETMAR Peptide - middle region

Product Specifications

Product Name Alternative

Mar1, HsMar1, METNASE

UniProt

Q53H47

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001230652.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF792 antibody
70R-35182 100 ug

ZNF792 antibody

Sign In for Pricing
View Details
Mpt51 Antibody, HRP conjugated
CSB-PA14937B0Rb-01 50 µg

Mpt51 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mpt51 Antibody, HRP conjugated
CSB-PA14937B0Rb-02 100 µg

Mpt51 Antibody, HRP conjugated

Sign In for Pricing
View Details
SPIN2 AAV Vector (Mouse) (CMV)
45320104 1 µg

SPIN2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
anti-ARC
YF-PA27515 50 ug

anti-ARC

Sign In for Pricing
View Details
SLA2 Over-expression Lysate Product
GWB-350A5E 0.1 mg

SLA2 Over-expression Lysate Product

Sign In for Pricing
View Details