Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIC Peptide - middle region

PPIC Peptide - middle region

Product Specifications

Product Name Alternative

CYPC

UniProt

P45877

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000934.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFI

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD12 Rabbit Polyclonal Antibody (HRP)
orb2100962 100 µL

PSMD12 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Estrogen Receptor, beta (ERb) (Biotin) discontinued
E3565-16E-Biotin 100 µL

Estrogen Receptor, beta (ERb) (Biotin) discontinued

Sign In for Pricing
View Details
Human FKBP51 (FKBP5) (NM_001145776) AAV Particle
RC227040A1V 250 µL

Human FKBP51 (FKBP5) (NM_001145776) AAV Particle

Sign In for Pricing
View Details
Phospho-Mnk1 (Thr197/202) Antibody
CST 2111S 100 µL

Phospho-Mnk1 (Thr197/202) Antibody

Sign In for Pricing
View Details
GGTLC2 Lentiviral Activation Particles (h2)
sc-403507-LAC-2 200 µL

GGTLC2 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RBM43, NT (RBM43, C2orf38, RNA-binding protein 43, RNA-binding motif protein 43) (AP) discontinued
040898-AP 200 µL

RBM43, NT (RBM43, C2orf38, RNA-binding protein 43, RNA-binding motif protein 43) (AP) discontinued

Sign In for Pricing
View Details