Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIC Peptide - middle region

PPIC Peptide - middle region

Product Specifications

Product Name Alternative

CYPC

UniProt

P45877

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000934.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYP11A1 Knockout HEK293T cell line
GTR15418775 1 Vial

Human CYP11A1 Knockout HEK293T cell line

Sign In for Pricing
View Details
RPL5 Antibody - N-terminal region
OAAB05853-400UL 400 µL

RPL5 Antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)
MBS1220238-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)
MBS1220238-02 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)
MBS1220238-03 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)
MBS1220238-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Thioredoxin-3 (trxC)

Sign In for Pricing
View Details