Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTK1 Peptide - middle region

GSTK1 Peptide - middle region

Product Specifications

Product Name Alternative

GST, GST13, hGSTK1, GSTK1-1, GST13-13, GST 13-13

UniProt

Q9Y2Q3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137151.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOPORS-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47313061 1.0 µg DNA

TOPORS-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
EPB41 Antibody
A21283-100UG 100 µg

EPB41 Antibody

Sign In for Pricing
View Details
Mouse Ctsf Pre-designed siRNA Set A
SI103227A 1 Each

Mouse Ctsf Pre-designed siRNA Set A

Sign In for Pricing
View Details
1-((2R)-2-Amino-2-cyclohexylacetyl)-N-(4'-cyanobenzyl)-2-L-azetidinecarboxamide
MBS6075216-01 5 mg

1-((2R)-2-Amino-2-cyclohexylacetyl)-N-(4'-cyanobenzyl)-2-L-azetidinecarboxamide

Sign In for Pricing
View Details
1-((2R)-2-Amino-2-cyclohexylacetyl)-N-(4'-cyanobenzyl)-2-L-azetidinecarboxamide
MBS6075216-02 5x 5 mg

1-((2R)-2-Amino-2-cyclohexylacetyl)-N-(4'-cyanobenzyl)-2-L-azetidinecarboxamide

Sign In for Pricing
View Details
Human DAOA qPCR Primer Pair
QH70429S 200 Tests

Human DAOA qPCR Primer Pair

Sign In for Pricing
View Details