GSTK1 Peptide - middle region
GSTK1 Peptide - middle region
Product Specifications
Product Name Alternative
GST, GST13, hGSTK1, GSTK1-1, GST13-13, GST 13-13
UniProt
Q9Y2Q3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001137151.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV641803 1.0 µg DNA
FAM135A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
PO55066M1 100 µg
Influenza A H3N2 (A/swine/China/JG20/2019) Neuraminidase / NA (His Tag)
Sign In for Pricing
View Details VAng-Wyb0028-50gEcoli 50 µg (E. coli)
Recombinant Leptospira Biflexa dapA protein (aa 1-294) (strain Patoc 1 / ATCC 23582 / Paris)
Sign In for Pricing
View Details 
30613061 1.0 µg DNA
MRS2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details DKB74543-01 50 mg
4- (Aminomethyl) -N, N-diethylbenzene-1-sulfonamide hydrochloride
Sign In for Pricing
View Details