Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Peptide - middle region

CTNND1 Peptide - middle region

Product Specifications

Product Name Alternative

CAS, p120, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001078927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serine Palmitoyltransferase (SPTLC2) (NM_004863) Human Over-expression Lysate
LY401528 100 µg

Serine Palmitoyltransferase (SPTLC2) (NM_004863) Human Over-expression Lysate

Sign In for Pricing
View Details
KIAA0100 Recombinant Mouse Monoclonal Antibody [A0-F3-R]
HA601317 100 µL

KIAA0100 Recombinant Mouse Monoclonal Antibody [A0-F3-R]

Sign In for Pricing
View Details
Atractyligenin
TRC-A794525-1MG 1 mg

Atractyligenin

Sign In for Pricing
View Details
Recombinant Mouse CD80/B7-1 Protein (Fc Tag)
PKSM040680 100 µg

Recombinant Mouse CD80/B7-1 Protein (Fc Tag)

Sign In for Pricing
View Details
Human Crystallin Alpha B (CRYaB) ELISA Kit
RDR-CRYaB-Hu-01 96 Tests

Human Crystallin Alpha B (CRYaB) ELISA Kit

Sign In for Pricing
View Details
Human Crystallin Alpha B (CRYaB) ELISA Kit
RDR-CRYaB-Hu-02 48 Tests

Human Crystallin Alpha B (CRYaB) ELISA Kit

Sign In for Pricing
View Details