Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Peptide - middle region

CTNND1 Peptide - middle region

Product Specifications

Product Name Alternative

CAS, p120, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001078927.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), 1mg/mL
BNUM2038-50 1x 50 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), 1mg/mL

Sign In for Pricing
View Details
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
CF812509 100 µg

LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI1F4]

Sign In for Pricing
View Details
Butanoic Acid
TRC-B692235-250G 250 g

Butanoic Acid

Sign In for Pricing
View Details
AKAP2 Human Gene Knockout Kit (CRISPR)
KN217988 1 Kit

AKAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Screen Quest™ Membrane Potential Assay Kit *Orange Fluorescence*
35999-AAT 1 Plate

Screen Quest™ Membrane Potential Assay Kit *Orange Fluorescence*

Sign In for Pricing
View Details
OR51E2 Rabbit Polyclonal Antibody
TA384912 100 µL

OR51E2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details