Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - middle region

MCCC1 Peptide - middle region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q96RQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCOTH activation kit by CRISPRa
GA118614 1 Kit

Human PCOTH activation kit by CRISPRa

Sign In for Pricing
View Details
rac N-Acetyl-Pseudoephedrine
TRC-A187610-25MG 25 mg

rac N-Acetyl-Pseudoephedrine

Sign In for Pricing
View Details
(9H-Purin-6-ylamino)acetic Acid (may contain up to 20% of inorganics)
TRC-P840293-25MG 25 mg

(9H-Purin-6-ylamino)acetic Acid (may contain up to 20% of inorganics)

Sign In for Pricing
View Details
Oleoyl-L-carnitine
TRC-O526700-25MG 25 mg

Oleoyl-L-carnitine

Sign In for Pricing
View Details
Recombinant SIN3A Monoclonal Antibody
AN302059L-01 50 µL

Recombinant SIN3A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SIN3A Monoclonal Antibody
AN302059L-02 100 µL

Recombinant SIN3A Monoclonal Antibody

Sign In for Pricing
View Details