Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - middle region

MCCC1 Peptide - middle region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q96RQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CentiMark PCR Marker, 5 x 50µg
NM2418 5 x 50μg

CentiMark PCR Marker, 5 x 50µg

Sign In for Pricing
View Details
CD32B (FCGR2B) Human qPCR Primer Pair (NM_004001)
HP227451 200 Reactions

CD32B (FCGR2B) Human qPCR Primer Pair (NM_004001)

Sign In for Pricing
View Details
Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit
RD-HSPB1-Hu-01 96 Tests

Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit
RD-HSPB1-Hu-02 48 Tests

Human Heat Shock 27kDa Protein 1 (HSPB1) ELISA Kit

Sign In for Pricing
View Details
ARL4C (NM_005737) Human Recombinant Protein
TP310286M 100 µg

ARL4C (NM_005737) Human Recombinant Protein

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis), CF568 conjugate, 0.1mg/mL
BNC681751-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details