Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKX Peptide - middle region

PRKX Peptide - middle region

Product Specifications

Product Name Alternative

PKX1

UniProt

O43930

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005035.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YPEL5 (NM_001127400) Human Over-expression Lysate
LC426782 20 µg

YPEL5 (NM_001127400) Human Over-expression Lysate

Sign In for Pricing
View Details
Hoechst 33342 maleimide
17672-AAT 1 mg

Hoechst 33342 maleimide

Sign In for Pricing
View Details
FLT3 (NM_004119) Human Over-expression Lysate
LY418194 100 µg

FLT3 (NM_004119) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706313 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
IFluor® 750 RGD Conjugate
36800-AAT 1 mg

IFluor® 750 RGD Conjugate

Sign In for Pricing
View Details
Salvianolic Acid A
TRC-S100800-5MG 5 mg

Salvianolic Acid A

Sign In for Pricing
View Details