SLC28A3 Peptide - middle region
SLC28A3 Peptide - middle region
Product Specifications
Product Name Alternative
CNT3
UniProt
Q9HAS3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001186562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-4228R-BF594-01 20 µL
VLDL Receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details bs-4228R-BF594-02 100 µL
VLDL Receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
MBS2148468-01 0.1 mL
PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)
Sign In for Pricing
View Details MBS2148468-02 0.2 mL
PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)
Sign In for Pricing
View Details MBS2148468-03 0.5 mL
PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)
Sign In for Pricing
View Details