SLC28A3 Peptide - middle region
SLC28A3 Peptide - middle region
Product Specifications
Product Name Alternative
CNT3
UniProt
Q9HAS3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001186562.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DXC58251-01 50 mg
3-[5- (Propan-2-yl) -1,3,4-oxadiazol-2-yl]morpholine, trifluoroacetic acid
Sign In for Pricing
View Details DXC58251-02 0.5 g
3-[5- (Propan-2-yl) -1,3,4-oxadiazol-2-yl]morpholine, trifluoroacetic acid
Sign In for Pricing
View Details 
bs-13686R-RBITC 100 µL
KAT5 / Tip60 Polyclonal Antibody, RBITC Conjugated
Sign In for Pricing
View Details NBP2-90372AF350 0.1 mL
Rabbit Monoclonal IGF-II/IGF2 Antibody (110) [Alexa Fluor 350]
Sign In for Pricing
View Details