What is the catalog number for SLC28A3 Peptide - middle region?

The catalog number for SLC28A3 Peptide - middle region is orb1999429.

What sizes are available for SLC28A3 Peptide - middle region?

SLC28A3 Peptide - middle region is available in the following size(s): 100 µg.

Is SLC28A3 Peptide - middle region in stock?

SLC28A3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SLC28A3 Peptide - middle region

Product Specifications

Product Name Alternative

CNT3

UniProt

Q9HAS3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS2531047-01 96 Tests

Human CAM (Calmodulin) CLIA Kit

Sign In for Pricing

View Details

MBS2531047-02 5x 96 Tests

Human CAM (Calmodulin) CLIA Kit

Sign In for Pricing

View Details

sc-525388 1 Kit

Cryopyrin (H-8) : m-IgGκ BP-HRP Bundle

Sign In for Pricing

View Details

18148 0.1 mg

Rabbit Anti Dog Alpha-1-Acid Glycoprotein

Sign In for Pricing

View Details

mm0572 1.0 mL

AdmiRa-mmu-mir-669n Virus

Sign In for Pricing

View Details

AMM11107V 100 µL

RNF156 (MGRN1) Mouse Monoclonal Antibody [Clone ID: LBI1A8]

Sign In for Pricing

View Details