Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBFA Peptide - middle region

RBFA Peptide - middle region

Product Specifications

Product Name Alternative

HsT169, C18orf22

UniProt

Q8N0V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001165438.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LASS4 Antibody
MBS853024-01 0.1 mg

LASS4 Antibody

Sign In for Pricing
View Details
LASS4 Antibody
MBS853024-02 0.1 mL (AF635)

LASS4 Antibody

Sign In for Pricing
View Details
LASS4 Antibody
MBS853024-03 0.1 mL (AF610)

LASS4 Antibody

Sign In for Pricing
View Details
LASS4 Antibody
MBS853024-04 0.1 mL (AF405S)

LASS4 Antibody

Sign In for Pricing
View Details
LASS4 Antibody
MBS853024-05 0.1 mL (AF405L)

LASS4 Antibody

Sign In for Pricing
View Details
LASS4 Antibody
MBS853024-06 0.1 mL (AF546)

LASS4 Antibody

Sign In for Pricing
View Details