RBFA Peptide - middle region
RBFA Peptide - middle region
Product Specifications
Product Name Alternative
HsT169, C18orf22
UniProt
Q8N0V3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001165438.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6387138-01 0.1 mL
NLRP3 (NACHT, LRR and PYD Domains-containing Protein 3, Angiotensin/Vasopressin Receptor AII/AVP-like, Caterpiller Protein 1.1, CLR1.1, Cold Autoinflammatory Syndrome 1 Protein, Cryopyrin, PYRIN-containing APAF1-like Protein 1, C1orf7, CIAS1, NALP3, PYPAF
Sign In for Pricing
View Details MBS6387138-02 5x 0.1 mL
NLRP3 (NACHT, LRR and PYD Domains-containing Protein 3, Angiotensin/Vasopressin Receptor AII/AVP-like, Caterpiller Protein 1.1, CLR1.1, Cold Autoinflammatory Syndrome 1 Protein, Cryopyrin, PYRIN-containing APAF1-like Protein 1, C1orf7, CIAS1, NALP3, PYPAF
Sign In for Pricing
View Details 