Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGGF1 Peptide - middle region

AGGF1 Peptide - middle region

Product Specifications

Product Name Alternative

VG5Q, GPATC7, GPATCH7, HSU84971, HUS84971

UniProt

Q8N302

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060516.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPYPTSSTKQSKDKKLKKKRKDPDSSATNEEKDLNSEDQKAFSVEHTSCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-TNIP1 Antibody, Affinity Purified
MBS3904680-01 0.01 mg

Rabbit anti-TNIP1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TNIP1 Antibody, Affinity Purified
MBS3904680-02 0.1 mg

Rabbit anti-TNIP1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TNIP1 Antibody, Affinity Purified
MBS3904680-03 5x 0.01 mg

Rabbit anti-TNIP1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TNIP1 Antibody, Affinity Purified
MBS3904680-04 5x 0.1 mg

Rabbit anti-TNIP1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Lentiviral human CD46 shRNA (UAS) - Lentiviral human CD46 shRNA (UAS) plasmid
GTR15326662 1 Vial

Lentiviral human CD46 shRNA (UAS) - Lentiviral human CD46 shRNA (UAS) plasmid

Sign In for Pricing
View Details
6-Bromo-N-ethyl-3,4-dihydro-2H-1-benzothiopyran-4-amine
EWB17790-01 50 mg

6-Bromo-N-ethyl-3,4-dihydro-2H-1-benzothiopyran-4-amine

Sign In for Pricing
View Details