Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGGF1 Peptide - middle region

AGGF1 Peptide - middle region

Product Specifications

Product Name Alternative

VG5Q, GPATC7, GPATCH7, HSU84971, HUS84971

UniProt

Q8N302

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060516.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPYPTSSTKQSKDKKLKKKRKDPDSSATNEEKDLNSEDQKAFSVEHTSCN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2E3 Antibody
MBS9602859-01 0.1 mL

UBE2E3 Antibody

Sign In for Pricing
View Details
UBE2E3 Antibody
MBS9602859-02 0.2 mL

UBE2E3 Antibody

Sign In for Pricing
View Details
UBE2E3 Antibody
MBS9602859-03 5x 0.2 mL

UBE2E3 Antibody

Sign In for Pricing
View Details
Anti-Ankyrin-B Antibody FL594 Conjugate
75-144-FL594 200 µL

Anti-Ankyrin-B Antibody FL594 Conjugate

Sign In for Pricing
View Details
Thapsigargin
1558-1 1 mg

Thapsigargin

Sign In for Pricing
View Details
LDB1 (LIM Domain Binding 1, LIM Domain-Binding Factor-1, OTTHUMP00000020360, Carboxy terminal LIM Domain Protein 2, CLIM2, NLI) (MaxLight 650)
MBS6226217-01 0.1 mL

LDB1 (LIM Domain Binding 1, LIM Domain-Binding Factor-1, OTTHUMP00000020360, Carboxy terminal LIM Domain Protein 2, CLIM2, NLI) (MaxLight 650)

Sign In for Pricing
View Details