Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP1 Peptide - C-terminal region

ACAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CENTB1

UniProt

Q15027

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055531.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD11 Antibody, HRP conjugated
CSB-PA00575B0Rb-01 50 µg

PSMD11 Antibody, HRP conjugated

Sign In for Pricing
View Details
PSMD11 Antibody, HRP conjugated
CSB-PA00575B0Rb-02 100 µg

PSMD11 Antibody, HRP conjugated

Sign In for Pricing
View Details
BUB1B (BUB1 Mitotic Checkpoint Serine/threonine Kinase B, BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1) (APC)
MBS6408985-01 0.1 mL

BUB1B (BUB1 Mitotic Checkpoint Serine/threonine Kinase B, BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1) (APC)

Sign In for Pricing
View Details
BUB1B (BUB1 Mitotic Checkpoint Serine/threonine Kinase B, BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1) (APC)
MBS6408985-02 5x 0.1 mL

BUB1B (BUB1 Mitotic Checkpoint Serine/threonine Kinase B, BUB1beta, BUBR1, Bub1A, MAD3L, SSK1, hBUBR1) (APC)

Sign In for Pricing
View Details
C3orf23 Rabbit Polyclonal Antibody (Cy3)
orb986608 100 µL

C3orf23 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
4-Benzyloxy Atorvastatin-d5 Acetonide tert-Butyl Ester
CS-T-49022 1 Each

4-Benzyloxy Atorvastatin-d5 Acetonide tert-Butyl Ester

Sign In for Pricing
View Details