Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPSNAP2 Peptide - middle region

NIPSNAP2 Peptide - middle region

Product Specifications

Product Name Alternative

GBAS

UniProt

O75323

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189398.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSTF2T siRNA
abx913023-01 15 nmol

Human CSTF2T siRNA

Sign In for Pricing
View Details
Human CSTF2T siRNA
abx913023-02 30 nmol

Human CSTF2T siRNA

Sign In for Pricing
View Details
Recombinant Human GIT2 Protein, N-His
MBS1578894-01 0.1 mg

Recombinant Human GIT2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GIT2 Protein, N-His
MBS1578894-02 1 mg

Recombinant Human GIT2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human GIT2 Protein, N-His
MBS1578894-03 5x 1 mg

Recombinant Human GIT2 Protein, N-His

Sign In for Pricing
View Details
LONP2 Antibody
orb674783-01 50 µg

LONP2 Antibody

Sign In for Pricing
View Details