Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCAN3 Peptide - middle region

RCAN3 Peptide - middle region

Product Specifications

Product Name Alternative

RCN3, MCIP3, hRCN3, DSCR1L2

UniProt

Q9UKA8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001238906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myoglobin Rabbit pAb
E45R25858N-100 100 µL

Myoglobin Rabbit pAb

Sign In for Pricing
View Details
CR025, ID (C18orf25, Uncharacterized protein C18orf25) (Biotin) discontinued
034195-Biotin 200 µL

CR025, ID (C18orf25, Uncharacterized protein C18orf25) (Biotin) discontinued

Sign In for Pricing
View Details
PLEKHG7 Protein Lysate
OCOA16832-20UG 20 µg

PLEKHG7 Protein Lysate

Sign In for Pricing
View Details
Recombinant Methanosphaera stadtmanae F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd)
MBS1357024-01 0.02 mg (E-Coli)

Recombinant Methanosphaera stadtmanae F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd)

Sign In for Pricing
View Details
Recombinant Methanosphaera stadtmanae F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd)
MBS1357024-02 0.02 mg (Yeast)

Recombinant Methanosphaera stadtmanae F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd)

Sign In for Pricing
View Details
Recombinant Methanosphaera stadtmanae F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd)
MBS1357024-03 0.1 mg (E-Coli)

Recombinant Methanosphaera stadtmanae F420-dependent methylenetetrahydromethanopterin dehydrogenase (mtd)

Sign In for Pricing
View Details