Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCAN3 Peptide - middle region

RCAN3 Peptide - middle region

Product Specifications

Product Name Alternative

RCN3, MCIP3, hRCN3, DSCR1L2

UniProt

Q9UKA8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001238906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPPASPPVGWKQSEDAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Natural Convection Incubator BINC-7804
BINC-7804 1 Unit

Natural Convection Incubator BINC-7804

Sign In for Pricing
View Details
INTS1 Rabbit Polyclonal Antibody (BF405)
orb2482895 100 µL

INTS1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant (E.coli) Sudan Ebola virus nucleoprotein (SUDV NP) (Uganda, 1-738aa, his-tag, >95%)
SVNP29-R-100 100 µg

Recombinant (E.coli) Sudan Ebola virus nucleoprotein (SUDV NP) (Uganda, 1-738aa, his-tag, >95%)

Sign In for Pricing
View Details
MGST2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1299705 3x 1.0 µg

MGST2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EpiQuik Tissue Acetyl-Histone H3 ChIP Kit
P-2012-48 48 Reactions

EpiQuik Tissue Acetyl-Histone H3 ChIP Kit

Sign In for Pricing
View Details
ARHGEF9 Antibody
MBS8505721-01 0.1 mg

ARHGEF9 Antibody

Sign In for Pricing
View Details