Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN3 Peptide - middle region

BIN3 Peptide - middle region

Product Specifications

UniProt

Q9NQY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061158.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSVFPSLNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIS1 Protein Vector (Rat) (pPM-C-His)
PV268597 500 ng

FIS1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TEX9 (NM_001286449) Human Tagged ORF Clone
RG237404 10 µg

TEX9 (NM_001286449) Human Tagged ORF Clone

Sign In for Pricing
View Details
Slit Homolog 1 (Slit1) Antibody (Biotin)
abx273291-01 200 µL

Slit Homolog 1 (Slit1) Antibody (Biotin)

Sign In for Pricing
View Details
Slit Homolog 1 (Slit1) Antibody (Biotin)
abx273291-02 1 mL

Slit Homolog 1 (Slit1) Antibody (Biotin)

Sign In for Pricing
View Details
Cntrob (NM_001134645) Rat Tagged ORF Clone
RR203932 10 µg

Cntrob (NM_001134645) Rat Tagged ORF Clone

Sign In for Pricing
View Details
SNX12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2254606 1.0 µg DNA

SNX12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details