Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN3 Peptide - middle region

BIN3 Peptide - middle region

Product Specifications

UniProt

Q9NQY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061158.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSVFPSLNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ileum
CR560966 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
AOX1-set siRNA/shRNA/RNAi Lentivector (Human)
12089091 4x 500 ng

AOX1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
BMI1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0186408 1.0 µg DNA

BMI1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-NUP35 Antibody, Affinity Purified
A301-781A 100 µg

Rabbit anti-NUP35 Antibody, Affinity Purified

Sign In for Pricing
View Details
Nitric Acid Solution 1.0M (1.0N)
VM8113-F 2.5 L

Nitric Acid Solution 1.0M (1.0N)

Sign In for Pricing
View Details
Anti-Myosin light polypeptide 6 MYL6 Antibody
A09646 100 µL

Anti-Myosin light polypeptide 6 MYL6 Antibody

Sign In for Pricing
View Details